PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000033.1_g00037.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 331aa    MW: 37368.2 Da    PI: 6.7785
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000033.1_g00037.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.41.4e-53131391129
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrFhPtdeel+++yL kk+ ++++ +  +i evd++kvePw+Lp k + +ekewyfF+ rdkky+tg r+nrat+sgyWkat
  Itr_sc000033.1_g00037.1  13 LPPGFRFHPTDEELITHYLSKKALDTSFCA-VAIGEVDMNKVEPWELPWKSRIGEKEWYFFCVRDKKYPTGMRTNRATASGYWKAT 97 
                              79*************************888.67***************888889******************************** PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                              gkdke+++ ++ lvg+kktLvfy+grapkgekt+Wv he+rle
  Itr_sc000033.1_g00037.1  98 GKDKEIFR-GKCLVGMKKTLVFYQGRAPKGEKTNWVCHEFRLE 139
                              ********.999****************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.92E-619164IPR003441NAC domain
PROSITE profilePS5100557.13613163IPR003441NAC domain
PfamPF023652.5E-2714138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MENLPGDDNQ MDLPPGFRFH PTDEELITHY LSKKALDTSF CAVAIGEVDM NKVEPWELPW  60
KSRIGEKEWY FFCVRDKKYP TGMRTNRATA SGYWKATGKD KEIFRGKCLV GMKKTLVFYQ  120
GRAPKGEKTN WVCHEFRLEG KLSVHNFPNA AQSDWVICRV FHKNSCGKNV HFPDTKSSVL  180
PPLTDSSTTT TTPPESGHVH CFSSLIPPEN KSLQQESMNM VNYLSNINPP LPSSSTADIS  240
PHPQTVFPWS QAVQTHGSTF LQNQDSFPIQ DPAILTSLLA GCGHRSFKTE KEMVCGSQET  300
EISSVVSNLE MGRRAFDDHQ NPQELDCLWS Y
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-541016914171NO APICAL MERISTEM PROTEIN
1ut4_B6e-541016914171NO APICAL MERISTEM PROTEIN
1ut7_A6e-541016914171NO APICAL MERISTEM PROTEIN
1ut7_B6e-541016914171NO APICAL MERISTEM PROTEIN
3swm_A7e-541016917174NAC domain-containing protein 19
3swm_B7e-541016917174NAC domain-containing protein 19
3swm_C7e-541016917174NAC domain-containing protein 19
3swm_D7e-541016917174NAC domain-containing protein 19
3swp_A7e-541016917174NAC domain-containing protein 19
3swp_B7e-541016917174NAC domain-containing protein 19
3swp_C7e-541016917174NAC domain-containing protein 19
3swp_D7e-541016917174NAC domain-containing protein 19
4dul_A6e-541016914171NAC domain-containing protein 19
4dul_B6e-541016914171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00496DAPTransfer from AT5G07680Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009587074.11e-129PREDICTED: NAC domain-containing protein 100-like
SwissprotQ9FLR31e-109NAC79_ARATH; NAC domain-containing protein 79
TrEMBLA0A068UVF51e-130A0A068UVF5_COFCA; Uncharacterized protein
STRINGSolyc03g115850.2.11e-126(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07680.11e-102NAC domain containing protein 80